Telecaller Consultant
White Force Outsourcing Pvt Ltd
Varaha is seeking a high-performing Field Investigator Consultant to lead critical on-ground assessments in the Wardha region. As a Consultant you will act as a subject matter expert on the ground responsible for the accuracy of sustainability data identifying local risks and providing actionable insights that influence project success.
This role requires a strong understanding of agricultural extension rural development audit or field research with a proven track record of delivering high-quality results in a fast-paced environment. The ideal candidate will possess excellent communication and stakeholder management skills with the ability to work effectively with local project participants and provide on-the-spot guidance and support.
The Field Investigator Consultant will be responsible for executing complex site investigations ensuring high-quality data collection that meets rigorous internal and client audit standards. They will also act as the primary interface with local stakeholders providing on-the-spot guidance resolving project-related queries and identifying potential barriers to project implementation.
In addition the Field Investigator Consultant will analyze field conditions and provide recommendations to the project management team regarding process improvements or risk mitigation. They will maintain professional relationships with local project participants to ensure continuous project engagement and ensure all site activities are audit-ready and comply with global sustainability standards.
The ideal candidate will have a strong understanding of sustainability principles and practices with a proven track record of delivering high-quality results in a fast-paced environment. They will possess excellent communication and stakeholder management skills with the ability to work effectively with local project participants and provide on-the-spot guidance and support.
Varaha offers a competitive salary and benefits package as well as opportunities for professional growth and development. If you are a motivated and detail-oriented professional with a passion for sustainability and project management we encourage you to apply for this exciting opportunity.
Required Skills:
ProvenexperienceinagriculturalextensionruraldevelopmentauditorfieldresearchExcellentcommunicationandstakeholdermanagementskillsAbilitytoworkeffectivelyinafast-pacedenvironmentStronganalyticalandproblem-solvingskillsAbilitytoprovideon-the-spotguidanceandsupport
- Overview CE handles single/multiple distributors ranging over different scale of business. He is the representation of PepsiCo in market who is responsible for planning, deploying and executing joint business plans and driving sustainable sales capability. The CE will help...Suggested
Rs 7 - 9 lakhs p.a.
...Consultant Doctor Berkowits Hair & Skin Clinics Golf Course Haryana Location: A1-233 Sushant Lok Road Golf Course Road (Opposite Pillar No. 238) Sector 55 Gurugram Haryana 122011 Salary: 7 Lakh to 9 Lakh per year (CTC) Experience: 2 to 5 years Qualification:...SuggestedPermanent employmentFull timeContract workWeekend workWeekday workBerkowits
Gurgaon12 hours ago- ...Fraud Notice. the Role: At Splash we ensure that all our clients are assisted by our most experienced and high-performing Product Consultants. Our goal is to resolve client issues efficiently while delivering an exceptional experience. As a Product Consultant you will play...SuggestedLong term contractFull timeWorldwide
Cvent
Gurgaon12 hours ago - "Executive Assistant • Minute taking and actions follow up • Exec time & labour and team approvals • Expenses – Exec submission • PO/Invoice administration • Exec travel and accommodation • EA corp card monthly reconciliation • Preparing documents and presentations...Suggested
- ...providers, with unmatched capabilities in enterprise-scale AI, cloud, security, connectivity, data centers and application services. our consulting and Industry solutions help organizations and society move confidently and sustainably into the digital future. As a Global Top...SuggestedHybrid workWork at officeRemote jobFlexible hoursNight shift
- ...want to be part of an inclusive, adaptable, and forward-thinking organization, apply now. We are currently seeking a CW-EC Lead Consultant to join our team in Noida, Uttar Pradesh (IN-UP), India (IN). Key Responsibilities Lead end-to-end implementation of SuccessFactors...Full timeSide jobHybrid workWork at officeLocal areaRemote jobFlexible hours
- ...Requisition Id: 1760391 Consultant EY is looking for Consultant. T he opportunity As a Consultant you will help the team deliver and contribute to the profitable growth by ensuring client engagements are executed in an efficient manner....Contract workFlexible hours
- ...fulfilling experiences throughout your career to help you on the path to becoming your best professional self. The opportunity : Senior Consultant-GOV-Tech Consulting-CNS - TC - Technology Strategy & Transformation - New Delhi GOV : Our Global Government & Public Sector (GPS...Long term contractLocal areaImmediate start
- ...fulfilling experiences throughout your career to help you on the path to becoming your best professional self. The opportunity : Senior Consultant-FS-Tech Consulting-CNS - TC - Cyber Security - Gurgaon FS : Finance fuels our lives. Banking, Insurance and Wealth management,...Long term contractImmediate start
- ...fulfilling experiences throughout your career to help you on the path to becoming your best professional self. The opportunity : Senior Consultant-National-Tech Consulting-CNS - TC - AI and Data - Noida National : National comprises of sector agnostic teams working across...Long term contractImmediate start
Rs 4.5 - 5 lakhs p.a.
Actively hiring Social Media Marketing Manager Start Date Starts Immediately CTC (ANNUAL) ₹ 4,50,000 - 5,00,000 ₹ 4,50,000 - 5,00,000 /year ...Full timeWork at officeImmediate startRs 3 - 6.5 lakhs p.a.
Telecaller Start Date Starts Immediately CTC (ANNUAL) ₹ 3,00,000 - 6,50,000 ₹ 3,00,000 - 6,50,000 /year Experience...Immediate startRs 5.4 lakh p.a.
Actively hiring Social Media Manager Start Date Starts Immediately CTC (ANNUAL) ₹ 5,40,000 ₹ 5,40,000 /year Experience...Immediate startRs 2.5 - 3.1 lakhs p.a.
Junior Social Media Marketing Executive Start Date Starts Immediately CTC (ANNUAL) ₹ 2,50,000 - 3,10,000 ₹ 2,50,000 - 3,10,000 /year ...Work at officeImmediate start- ...Job Code-117868 Job Title- IND Consultant I GSMS-Proposals Management ARL- 6.1 Solution Line- GSMS Position type- Full Time Work Location- Bangalore/Gurugram Working style- In Office Cab Facility- Yes People Manager role: No Required education and certifications critical for...Full timeWork at office
Rs 13.4 lakh p.a.
Airbnb was born in 2007 when two hosts welcomed three guests to their San Francisco home, and has since grown to over 5 million hosts who have welcomed over 2 billion guest arrivals in almost every country across the globe. Every day, hosts offer unique stays and experiences...Work at officeShift workWeekend workAfternoon shiftRs 15000 - Rs 25000 per month
...About the Opportunity Beyond Border Consultants is a dynamic marketing and brand growth agency operating at the intersection of digital strategy, social commerce, and cross-border audience engagement. We help emerging and established brands amplify their voice, build loyal...Rs 3 - 7 lakhs p.a.
About the Opportunity A fast-scaling B2B marketing agency powering growth for enterprise tech, SaaS, and startup clients across India and global markets. We build data-driven, platform-optimized social media strategies that convert engagement into pipeline—blending creative...Flexible hours- #CUSTOMER SERVICE ASSOCIATE International Voice Process – US Banking & Card Services 1. About the Role As a Customer Service Associate, you will support customers through an international voice process for US banking and card services. You will resolve enquiries...Full timeWork at officeUS shiftShift workNight shift
- Louis Dreyfus Company is a leading merchant and processor of agricultural goods. Our activities span the entire value chain from farm to fork, across a broad range of business lines, we leverage our global reach and extensive asset network to serve our customers and consumers...Full timeLocal area
- ...analyzing AI-driven insights or exploring AIs potential impact on the function or industry. ~10 years of experience in pre-sales Solution Consulting Sales Engineering Enterprise Architecture Technology Consulting or a comparable customer-facing technology role. ~ Strong domain...Full timeWork at officeRemote jobFlexible hours
ServiceNow
Gurgaon3 days ago - ...relationships with buy-side and sell-side contacts across the Indian polyolefin supply chain to gather primary intelligence and support custom consulting projects. You Have: ~7 years of chemical industry experience with direct commercial polyolefins (PE/PP) experience and a...Full timeLocal area
Dow Jones & Company
New Delhi1 day ago - ...Remote Travel Consultant 100% Remote Ever dreamed of turning your hustle into real income from anywhere in the world Dreamport is looking for ambitious sales-driven people ready to build their own freelance travel consulting business. No office. No fixed hours. Just you...Full timeFreelanceWork at officeRemote job
Dreamport
Gurgaon1 day ago - ...Job Title: Performance and Reward Consultant ~ The P&R Consultant provides insight-led consulting and decision support across performance and reward. Based in Hyderabad, the role will initially support Europe activities, working with P&R Partners, Country People Heads and...Permanent employmentFlexible hours
- ...providers, with unmatched capabilities in enterprise-scale AI, cloud, security, connectivity, data centers and application services. our consulting and Industry solutions help organizations and society move confidently and sustainably into the digital future. As a Global Top...Hybrid workWork at officeRemote jobFlexible hours
- ...providers, with unmatched capabilities in enterprise-scale AI, cloud, security, connectivity, data centers and application services. our consulting and Industry solutions help organizations and society move confidently and sustainably into the digital future. As a Global Top...Hybrid workWork at officeRemote jobFlexible hoursNight shiftWeekend work
- Job Title: Cardiology Application Support Analyst Job Summary We are seeking an experienced Cardiology Application Support Analyst / SME to provide production support, maintenance, monitoring, and operational support for Cardiology applications. The role will support ...Night shiftWeekend work
Rs 2.16 - 3.5 lakhs p.a.
Telecaller Start Date Starts Immediately CTC (ANNUAL) ₹ 2,16,000 - 3,50,000 ₹ 2,16,000 - 3,50,000 /year Experience...Immediate startRs 2.1 - 2.3 lakhs p.a.
Social Media Executive Start Date Starts Immediately CTC (ANNUAL) ₹ 2,10,000 - 2,30,000 ₹ 2,10,000 - 2,30,000 /year ...Immediate startRs 2.04 - 2.52 lakhs p.a.
Customer Service Associate Start Date Starts Immediately CTC (ANNUAL) ₹ 2,04,000 - 2,52,000 ₹ 2,04,000 - 2,52,000 /year ...Immediate start
Do you want to receive more vacancies?
Subscribe and receive similar vacancies to Telecaller Consultant. Be the first to apply!
